SCOP 1.57: Domain d1jjhb_: 1jjh B:

Lineage for d1jjhb_ (1jjh B:)

1. Root: SCOP 1.57

2. Class d: Alpha and beta proteins (a+b) [53931] (194 folds)

3. Fold d.58: Ferredoxin-like [54861] (36 superfamilies)

4. Superfamily d.58.8: Viral DNA-binding domain [54957] (1 family)

5. Family d.58.8.1: Viral DNA-binding domain [54958] (2 proteins)

6. Protein Papillomavirus-1 E2 protein [54959] (4 species)

7. Species Bovine papillomavirus type 1 [TaxId:10559] [54960] (3 PDB entries)

8. Domain d1jjhb_: 1jjh B: [63120]

Details for d1jjhb_

PDB Entry: 1jjh, 2.5 Å

PDB Description: e2 dna-binding domain from bovine papillomavirus type 1

SCOP Domain Sequences for d1jjhb_:

Sequence, based on SEQRES records:

>d1jjhb_ d.58.8.1 (B:) Papillomavirus-1 E2 protein {Bovine papillomavirus type 1}
ascfalisgtanqvkcyrfrvkknhrhryenctttwftvadngaerqgqaqilitfgsps
qrqdflkhvplppgmnisgftasldf

Sequence, based on observed residues (ATOM records):

>d1jjhb_ d.58.8.1 (B:) Papillomavirus-1 E2 protein {Bovine papillomavirus type 1}
ascfalisgtanqvkcyrfrvkknhrhryenctttwftvaqaqilitfgspsqrqdflkh
vplppgmnisgftasldf

Timeline for d1jjhb_:

• d1jjhb_ is new in SCOP 1.57
  
• d1jjhb_ appears in SCOP 1.59
  
• d1jjhb_ appears in the current release, SCOPe 2.08, called d1jjhb1