Lineage for d1jjha_ (1jjh A:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 80004Fold d.58: Ferredoxin-like [54861] (36 superfamilies)
  4. 80396Superfamily d.58.8: Viral DNA-binding domain [54957] (1 family) (S)
  5. 80397Family d.58.8.1: Viral DNA-binding domain [54958] (2 proteins)
  6. 80404Protein Papillomavirus-1 E2 protein [54959] (4 species)
  7. 80405Species Bovine papillomavirus type 1 [TaxId:10559] [54960] (3 PDB entries)
  8. 80407Domain d1jjha_: 1jjh A: [63119]

Details for d1jjha_

PDB Entry: 1jjh (more details), 2.5 Å

PDB Description: e2 dna-binding domain from bovine papillomavirus type 1

SCOP Domain Sequences for d1jjha_:

Sequence, based on SEQRES records: (download)

>d1jjha_ d.58.8.1 (A:) Papillomavirus-1 E2 protein {Bovine papillomavirus type 1}
ascfalisgtanqvkcyrfrvkknhrhryenctttwftvadngaerqgqaqilitfgsps
qrqdflkhvplppgmnisgftasldf

Sequence, based on observed residues (ATOM records): (download)

>d1jjha_ d.58.8.1 (A:) Papillomavirus-1 E2 protein {Bovine papillomavirus type 1}
ascfalisgtanqvkcyrfrvkknhrhryenctttwftvqaqilitfgspsqrqdflkhv
plppgmnisgftasldf

SCOP Domain Coordinates for d1jjha_:

Click to download the PDB-style file with coordinates for d1jjha_.
(The format of our PDB-style files is described here.)

Timeline for d1jjha_: