Lineage for d1jcga1 (1jcg A:1-140)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1605035Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1605036Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 1605037Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)
  6. 1605408Protein Prokaryotic actin homolog MreB [64087] (1 species)
  7. 1605409Species Thermotoga maritima [TaxId:2336] [64088] (4 PDB entries)
  8. 1605418Domain d1jcga1: 1jcg A:1-140 [62880]
    complexed with anp, mg

Details for d1jcga1

PDB Entry: 1jcg (more details), 3.1 Å

PDB Description: mreb from thermotoga maritima, amppnp
PDB Compounds: (A:) rod shape-determining protein mreb

SCOPe Domain Sequences for d1jcga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jcga1 c.55.1.1 (A:1-140) Prokaryotic actin homolog MreB {Thermotoga maritima [TaxId: 2336]}
mlrkdigidlgtantlvflrgkgivvnepsviaidsttgeilkvgleaknmigktpatik
airpmrdgviadytvalvmlryfinkakggmnlfkprvvigvpigitdverraildagle
agaskvflieepmaaaigsn

SCOPe Domain Coordinates for d1jcga1:

Click to download the PDB-style file with coordinates for d1jcga1.
(The format of our PDB-style files is described here.)

Timeline for d1jcga1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jcga2