SCOPe 2.07: Domain d1jcea2: 1jce A:141-336

Lineage for d1jcea2 (1jce A:141-336)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)

6. Protein Prokaryotic actin homolog MreB [64087] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [64088] (4 PDB entries)

8. Domain d1jcea2: 1jce A:141-336 [62877]

Details for d1jcea2

PDB Entry: 1jce, 2.1 Å

PDB Description: mreb from thermotoga maritima

PDB Compounds: (A:) rod shape-determining protein mreb

SCOPe Domain Sequences for d1jcea2:

Sequence; same for both SEQRES and ATOM records:

>d1jcea2 c.55.1.1 (A:141-336) Prokaryotic actin homolog MreB {Thermotoga maritima [TaxId: 2336]}
lnveepsgnmvvdigggttevavislgsivtwesiriagdemdeaivqyvretyrvaige
rtaervkieignvfpskendelettvsgidlstglprkltlkggevrealrsvvvaives
vrttlektppelvsdiiergifltgggsllrgldtllqketgisvirseepltavakgag
mvldkvnilkklqgag

Timeline for d1jcea2:

• d1jcea2 first appeared in SCOP 1.57
  
• d1jcea2 appears in SCOPe 2.06
  
• d1jcea2 appears in the current release, SCOPe 2.08