Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily) beta-alpha-beta(3); 2 layers: alpha/beta |
Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) |
Family d.32.1.4: Methylmalonyl-CoA epimerase [64257] (1 protein) Different association of repeats but a similar dimeric structure to the glyoxalase dimer automatically mapped to Pfam PF13669 |
Protein Methylmalonyl-CoA epimerase [64258] (1 species) |
Species Propionibacterium shermanii [TaxId:1752] [64259] (2 PDB entries) |
Domain d1jc5e_: 1jc5 E: [62871] complexed with so4 |
PDB Entry: 1jc5 (more details), 2.2 Å
SCOPe Domain Sequences for d1jc5e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jc5e_ d.32.1.4 (E:) Methylmalonyl-CoA epimerase {Propionibacterium shermanii [TaxId: 1752]} edlficidhvayacpdadeaskyyqetfgwhelhreenpeqgvveimmapaakltehmtq vqvmaplndestvakwlakhngraglhhmawrvddidavsatlrergvqllydepklgtg gnrinfmhpksgkgvlieltqypkn
Timeline for d1jc5e_: