SCOPe 2.06: Domain d1jc5d_: 1jc5 D:

Lineage for d1jc5d_ (1jc5 D:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
   beta-alpha-beta(3); 2 layers: alpha/beta

4. Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families)

5. Family d.32.1.4: Methylmalonyl-CoA epimerase [64257] (1 protein)
   Different association of repeats but a similar dimeric structure to the glyoxalase dimer
   automatically mapped to Pfam PF13669

6. Protein Methylmalonyl-CoA epimerase [64258] (1 species)

7. Species Propionibacterium shermanii [TaxId:1752] [64259] (2 PDB entries)

8. Domain d1jc5d_: 1jc5 D: [62870]
   complexed with so4

Details for d1jc5d_

PDB Entry: 1jc5, 2.2 Å

PDB Description: Crystal Structure of Native Methylmalonyl-CoA Epimerase

PDB Compounds: (D:) Methylmalonyl-CoA Epimerase

SCOPe Domain Sequences for d1jc5d_:

Sequence; same for both SEQRES and ATOM records:

>d1jc5d_ d.32.1.4 (D:) Methylmalonyl-CoA epimerase {Propionibacterium shermanii [TaxId: 1752]}
edlficidhvayacpdadeaskyyqetfgwhelhreenpeqgvveimmapaakltehmtq
vqvmaplndestvakwlakhngraglhhmawrvddidavsatlrergvqllydepklgtg
gnrinfmhpksgkgvlieltqypkn

Timeline for d1jc5d_:

• d1jc5d_ first appeared in SCOP 1.57
  
• d1jc5d_ appears in SCOPe 2.05
  
• d1jc5d_ appears in SCOPe 2.07
  
• d1jc5d_ appears in the current release, SCOPe 2.08