Lineage for d1jbul_ (1jbu L:)

  1. Root: SCOPe 2.01
  2. 1061255Class g: Small proteins [56992] (90 folds)
  3. 1061532Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 1062283Superfamily g.3.11: EGF/Laminin [57196] (7 families) (S)
  5. 1062284Family g.3.11.1: EGF-type module [57197] (23 proteins)
  6. 1062293Protein Coagulation factor VIIa [57201] (1 species)
  7. 1062294Species Human (Homo sapiens) [TaxId:9606] [57202] (17 PDB entries)
    Uniprot P08709 108-202 ! Uniprot P08709 107-202
  8. 1062299Domain d1jbul_: 1jbu L: [62857]
    Other proteins in same PDB: d1jbuh_
    complexed with ben, so4

Details for d1jbul_

PDB Entry: 1jbu (more details), 2 Å

PDB Description: coagulation factor vii zymogen (egf2/protease) in complex with inhibitory exosite peptide a-183
PDB Compounds: (L:) Coagulation factor VII

SCOPe Domain Sequences for d1jbul_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jbul_ g.3.11.1 (L:) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]}
icvnenggceqycsdhtgtkrscrchegyslladgvsctptveypcgkipilek

SCOPe Domain Coordinates for d1jbul_:

Click to download the PDB-style file with coordinates for d1jbul_.
(The format of our PDB-style files is described here.)

Timeline for d1jbul_: