SCOPe 2.07: Domain d1jb7a2: 1jb7 A:205-328

Lineage for d1jb7a2 (1jb7 A:205-328)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families)

5. Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (13 proteins)
   barrel, closed; n=5, S=10

6. Protein Telomere end binding protein alpha subunit [50273] (1 species)
   duplication: consists of three domains of this fold

7. Species Oxytricha nova [TaxId:200597] [50274] (16 PDB entries)

8. Domain d1jb7a2: 1jb7 A:205-328 [62837]
   Other proteins in same PDB: d1jb7b_
   protein/DNA complex; complexed with cl, na

Details for d1jb7a2

PDB Entry: 1jb7, 1.86 Å

PDB Description: DNA G-Quartets in a 1.86 A Resolution Structure of an Oxytricha nova Telomeric Protein-DNA Complex

PDB Compounds: (A:) Telomere-binding protein alpha subunit

SCOPe Domain Sequences for d1jb7a2:

Sequence; same for both SEQRES and ATOM records:

>d1jb7a2 b.40.4.3 (A:205-328) Telomere end binding protein alpha subunit {Oxytricha nova [TaxId: 200597]}
vissdmytalnkaqaqkgdfdvvakilqvheldeytnelklkdasgqvfytlslklkfph
vrtgevvrirsatydetstqkkvlilshysniitfiqssklakelrakiqddhsvevasl
kknv

Timeline for d1jb7a2:

• d1jb7a2 first appeared in SCOP 1.57
  
• d1jb7a2 appears in SCOPe 2.06
  
• d1jb7a2 appears in the current release, SCOPe 2.08