Class b: All beta proteins [48724] (180 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) contains copper-binding site |
Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins) |
Protein Nitrite reductase, NIR, N-terminal domain [418910] (5 species) |
Species Alcaligenes faecalis, strain s-6 [TaxId:511] [419326] (31 PDB entries) Uniprot P38501 |
Domain d1j9tc1: 1j9t C:4-166 [62787] Other proteins in same PDB: d1j9ta2, d1j9tb2, d1j9tc2 complexed with cu, no2 |
PDB Entry: 1j9t (more details), 1.95 Å
SCOPe Domain Sequences for d1j9tc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j9tc1 b.6.1.3 (C:4-166) Nitrite reductase, NIR, N-terminal domain {Alcaligenes faecalis, strain s-6 [TaxId: 511]} ataaeiaalprqkvelvdppfvhahsqvaeggpkvveftmvieekkividdagtevhama fngtvpgplmvvhqddyleltlinpetntlmhnidfhaatgalgggglteinpgektilr fkatkpgvfvyhcappgmvpwhvvsgmngaimvlpreglhdgk
Timeline for d1j9tc1:
View in 3D Domains from other chains: (mouse over for more information) d1j9ta1, d1j9ta2, d1j9tb1, d1j9tb2 |