Lineage for d1j9ta1 (1j9t A:4-166)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2770398Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2770399Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2771244Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins)
  6. 2771729Protein Nitrite reductase, NIR, N-terminal domain [418910] (5 species)
  7. 2771790Species Alcaligenes faecalis, strain s-6 [TaxId:511] [419326] (31 PDB entries)
    Uniprot P38501
  8. 2771857Domain d1j9ta1: 1j9t A:4-166 [62783]
    Other proteins in same PDB: d1j9ta2, d1j9tb2, d1j9tc2
    complexed with cu, no2

Details for d1j9ta1

PDB Entry: 1j9t (more details), 1.95 Å

PDB Description: crystal structure of nitrite soaked reduced h255n afnir
PDB Compounds: (A:) Copper-containing nitrite reductase

SCOPe Domain Sequences for d1j9ta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j9ta1 b.6.1.3 (A:4-166) Nitrite reductase, NIR, N-terminal domain {Alcaligenes faecalis, strain s-6 [TaxId: 511]}
ataaeiaalprqkvelvdppfvhahsqvaeggpkvveftmvieekkividdagtevhama
fngtvpgplmvvhqddyleltlinpetntlmhnidfhaatgalgggglteinpgektilr
fkatkpgvfvyhcappgmvpwhvvsgmngaimvlpreglhdgk

SCOPe Domain Coordinates for d1j9ta1:

Click to download the PDB-style file with coordinates for d1j9ta1.
(The format of our PDB-style files is described here.)

Timeline for d1j9ta1: