Lineage for d1j95d_ (1j95 D:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2629055Fold f.14: Gated ion channels [81325] (2 superfamilies)
    oligomeric transmembrane alpha-helical proteins
  4. 2629056Superfamily f.14.1: Voltage-gated ion channels [81324] (3 families) (S)
    Pfam PF00520
  5. 2629057Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins)
  6. 2629078Protein Potassium channel protein [56901] (3 species)
  7. 2629081Species Streptomyces coelicolor [TaxId:1902] [56902] (26 PDB entries)
    identical sequence to Streptomyces lividans, TaxId: 1916
    Uniprot Q54397 22-124
  8. 2629111Domain d1j95d_: 1j95 D: [62752]
    residues 24-121
    complexed with k, tba

Details for d1j95d_

PDB Entry: 1j95 (more details), 2.8 Å

PDB Description: kcsa potassium channel with tba (tetrabutylammonium) and potassium
PDB Compounds: (D:) Voltage-gated potassium channel

SCOPe Domain Sequences for d1j95d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j95d_ f.14.1.1 (D:) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]}
lhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdlyp
vtlwgrcvavvvmvagitsfglvtaalatwfvgreqer

SCOPe Domain Coordinates for d1j95d_:

Click to download the PDB-style file with coordinates for d1j95d_.
(The format of our PDB-style files is described here.)

Timeline for d1j95d_: