SCOPe 2.07: Domain d1j95b_: 1j95 B:

Lineage for d1j95b_ (1j95 B:)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.14: Gated ion channels [81325] (2 superfamilies)
   oligomeric transmembrane alpha-helical proteins

4. Superfamily f.14.1: Voltage-gated ion channels [81324] (3 families)
   Pfam PF00520

5. Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins)

6. Protein Potassium channel protein [56901] (3 species)

7. Species Streptomyces coelicolor [TaxId:1902] [56902] (26 PDB entries)
   identical sequence to Streptomyces lividans, TaxId: 1916
   Uniprot Q54397 22-124

8. Domain d1j95b_: 1j95 B: [62750]
   residues 24-121
   complexed with k, tba

Details for d1j95b_

PDB Entry: 1j95, 2.8 Å

PDB Description: kcsa potassium channel with tba (tetrabutylammonium) and potassium

PDB Compounds: (B:) Voltage-gated potassium channel

SCOPe Domain Sequences for d1j95b_:

Sequence; same for both SEQRES and ATOM records:

>d1j95b_ f.14.1.1 (B:) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]}
lhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdlyp
vtlwgrcvavvvmvagitsfglvtaalatwfvgreqer

Timeline for d1j95b_:

• d1j95b_ first appeared in SCOP 1.57
  
• d1j95b_ appears in SCOPe 2.06
  
• d1j95b_ appears in the current release, SCOPe 2.08