Lineage for d1j8mf2 (1j8m F:87-297)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 987024Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 987025Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 988943Family c.37.1.10: Nitrogenase iron protein-like [52652] (16 proteins)
    core: parallel beta-sheet of 7 strands; order 3241567
  6. 989077Protein GTPase domain of the signal sequence recognition protein Ffh [52664] (3 species)
  7. 989078Species Acidianus ambivalens [TaxId:2283] [64023] (2 PDB entries)
  8. 989080Domain d1j8mf2: 1j8m F:87-297 [62743]
    Other proteins in same PDB: d1j8mf1

Details for d1j8mf2

PDB Entry: 1j8m (more details), 2 Å

PDB Description: Signal Recognition Particle conserved GTPase domain from A. ambivalens
PDB Compounds: (F:) signal recognition 54 kda protein

SCOPe Domain Sequences for d1j8mf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j8mf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Acidianus ambivalens [TaxId: 2283]}
dkepkvipdkipyvimlvgvqgtgktttagklayfykkkgfkvglvgadvyrpaaleqlq
qlgqqigvpvygepgekdvvgiakrgvekflsekmeiiivdtagrhgygeeaalleemkn
iyeaikpdevtlvidasigqkaydlaskfnqaskigtiiitkmdgtakgggalsavaatg
atikfigtgekidelevfnprrfvarlhhhh

SCOPe Domain Coordinates for d1j8mf2:

Click to download the PDB-style file with coordinates for d1j8mf2.
(The format of our PDB-style files is described here.)

Timeline for d1j8mf2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1j8mf1