SCOPe 2.01: Domain d1j8mf1: 1j8m F:3-86

Lineage for d1j8mf1 (1j8m F:3-86)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.13: Domain of the SRP/SRP receptor G-proteins [47364] (1 family)

5. Family a.24.13.1: Domain of the SRP/SRP receptor G-proteins [47365] (3 proteins)

6. Protein Signal sequence recognition protein Ffh [47366] (3 species)

7. Species Acidianus ambivalens [TaxId:2283] [63538] (2 PDB entries)

8. Domain d1j8mf1: 1j8m F:3-86 [62742]
   Other proteins in same PDB: d1j8mf2

Details for d1j8mf1

PDB Entry: 1j8m, 2 Å

PDB Description: Signal Recognition Particle conserved GTPase domain from A. ambivalens

PDB Compounds: (F:) signal recognition 54 kda protein

SCOPe Domain Sequences for d1j8mf1:

Sequence; same for both SEQRES and ATOM records:

>d1j8mf1 a.24.13.1 (F:3-86) Signal sequence recognition protein Ffh {Acidianus ambivalens [TaxId: 2283]}
lldnlrdtvrkfltgsssydkavedfikelqkslisadvnvklvfsltnkikerlknekp
ptyierrewfikivydelsnlfgg

Timeline for d1j8mf1:

• d1j8mf1 first appeared in SCOP 1.57
  
• d1j8mf1 appears in SCOP 1.75
  
• d1j8mf1 appears in SCOPe 2.02
  
• d1j8mf1 appears in the current release, SCOPe 2.08