Lineage for d1j8mf1 (1j8m F:3-86)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 909860Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 910354Superfamily a.24.13: Domain of the SRP/SRP receptor G-proteins [47364] (1 family) (S)
  5. 910355Family a.24.13.1: Domain of the SRP/SRP receptor G-proteins [47365] (3 proteins)
  6. 910375Protein Signal sequence recognition protein Ffh [47366] (3 species)
  7. 910376Species Acidianus ambivalens [TaxId:2283] [63538] (2 PDB entries)
  8. 910378Domain d1j8mf1: 1j8m F:3-86 [62742]
    Other proteins in same PDB: d1j8mf2

Details for d1j8mf1

PDB Entry: 1j8m (more details), 2 Å

PDB Description: Signal Recognition Particle conserved GTPase domain from A. ambivalens
PDB Compounds: (F:) signal recognition 54 kda protein

SCOPe Domain Sequences for d1j8mf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j8mf1 a.24.13.1 (F:3-86) Signal sequence recognition protein Ffh {Acidianus ambivalens [TaxId: 2283]}
lldnlrdtvrkfltgsssydkavedfikelqkslisadvnvklvfsltnkikerlknekp
ptyierrewfikivydelsnlfgg

SCOPe Domain Coordinates for d1j8mf1:

Click to download the PDB-style file with coordinates for d1j8mf1.
(The format of our PDB-style files is described here.)

Timeline for d1j8mf1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1j8mf2