Lineage for d1j86a1 (1j86 A:1-85)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2753554Family b.1.1.4: I set domains [49159] (39 proteins)
  6. 2753734Protein IgE high affinity receptor alpha subunit [49200] (1 species)
    possibly an intermediate structure between the I set and FnIII domains
  7. 2753735Species Human (Homo sapiens) [TaxId:9606] [49201] (7 PDB entries)
    Uniprot P12319 29-196
  8. 2753756Domain d1j86a1: 1j86 A:1-85 [62711]
    complexed with nag

Details for d1j86a1

PDB Entry: 1j86 (more details), 3.2 Å

PDB Description: human high affinity fc receptor fc(epsilon)ri(alpha), monoclinic crystal form 2
PDB Compounds: (A:) high affinity immunoglobulin epsilon receptor alpha-subunit

SCOPe Domain Sequences for d1j86a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j86a1 b.1.1.4 (A:1-85) IgE high affinity receptor alpha subunit {Human (Homo sapiens) [TaxId: 9606]}
vpqkpkvslnppwnrifkgenvtltcngnnffevsstkwfhngslseetnsslnivnakf
edsgeykcqhqqvnesepvylevfs

SCOPe Domain Coordinates for d1j86a1:

Click to download the PDB-style file with coordinates for d1j86a1.
(The format of our PDB-style files is described here.)

Timeline for d1j86a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1j86a2