Lineage for d1j86a1 (1j86 A:1-85)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 54281Family b.1.1.4: I set domains [49159] (22 proteins)
  6. 54363Protein IgE high affinity receptor alpha subunit [49200] (1 species)
  7. 54364Species Human (Homo sapiens) [TaxId:9606] [49201] (6 PDB entries)
  8. 54367Domain d1j86a1: 1j86 A:1-85 [62711]

Details for d1j86a1

PDB Entry: 1j86 (more details), 3.2 Å

PDB Description: human high affinity fc receptor fc(epsilon)ri(alpha), monoclinic crystal form 2

SCOP Domain Sequences for d1j86a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j86a1 b.1.1.4 (A:1-85) IgE high affinity receptor alpha subunit {Human (Homo sapiens)}
vpqkpkvslnppwnrifkgenvtltcngnnffevsstkwfhngslseetnsslnivnakf
edsgeykcqhqqvnesepvylevfs

SCOP Domain Coordinates for d1j86a1:

Click to download the PDB-style file with coordinates for d1j86a1.
(The format of our PDB-style files is described here.)

Timeline for d1j86a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1j86a2