Lineage for d1io4d_ (1io4 D:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2803033Fold b.54: Core binding factor beta, CBF [50722] (1 superfamily)
    barrel, closed; n=6, S=10; meander; capped at both ends by alpha-helices
  4. 2803034Superfamily b.54.1: Core binding factor beta, CBF [50723] (1 family) (S)
    automatically mapped to Pfam PF02312
  5. 2803035Family b.54.1.1: Core binding factor beta, CBF [50724] (2 proteins)
  6. 2803036Protein Core binding factor beta, CBF [50725] (2 species)
  7. 2803045Species Mouse (Mus musculus) [TaxId:10090] [50727] (3 PDB entries)
  8. 2803046Domain d1io4d_: 1io4 D: [62617]
    Other proteins in same PDB: d1io4a_, d1io4b_, d1io4c_
    protein/DNA complex; complexed with au

Details for d1io4d_

PDB Entry: 1io4 (more details), 3 Å

PDB Description: crystal structure of runx-1/aml1/cbfalpha runt domain-cbfbeta core domain heterodimer and c/ebpbeta bzip homodimer bound to a dna fragment from the csf-1r promoter
PDB Compounds: (D:) core-binding factor, beta subunit

SCOPe Domain Sequences for d1io4d_:

Sequence, based on SEQRES records: (download)

>d1io4d_ b.54.1.1 (D:) Core binding factor beta, CBF {Mouse (Mus musculus) [TaxId: 10090]}
prvvpdqrskfeneeffrklsreceikytgfrdrpheerqtrfqnacrdgrseiafvatg
tnlslqffpaswqgeqrqtpsreyvdlereagkvylkapmilngvcviwkgwidlhrldg
mgclefdeeraqqedalaq

Sequence, based on observed residues (ATOM records): (download)

>d1io4d_ b.54.1.1 (D:) Core binding factor beta, CBF {Mouse (Mus musculus) [TaxId: 10090]}
prvvpdqrskfeneeffrklsreceikytgfrdrpheerqtrfqnacrdgrseiafvatg
tnlslqffpsreyvdlereagkvylkapmilngvcviwkgwidlhrldgmgclefdeera
qqedalaq

SCOPe Domain Coordinates for d1io4d_:

Click to download the PDB-style file with coordinates for d1io4d_.
(The format of our PDB-style files is described here.)

Timeline for d1io4d_: