SCOPe 2.06: Domain d1io4c_: 1io4 C:

Lineage for d1io4c_ (1io4 C:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.5: p53-like transcription factors [49417] (8 families)

5. Family b.2.5.6: RUNT domain [81318] (2 proteins)
   automatically mapped to Pfam PF00853

6. Protein Acute myeloid leukemia 1 protein (AML1), RUNT domain [49439] (2 species)
   synonym: core binding factor alpha, cbfa

7. Species Mouse (Mus musculus) [TaxId:10090] [63684] (14 PDB entries)
   almost identical sequence to the human protein

8. Domain d1io4c_: 1io4 C: [62616]
   Other proteins in same PDB: d1io4a_, d1io4b_, d1io4d_
   protein/DNA complex; complexed with au

Details for d1io4c_

PDB Entry: 1io4, 3 Å

PDB Description: crystal structure of runx-1/aml1/cbfalpha runt domain-cbfbeta core domain heterodimer and c/ebpbeta bzip homodimer bound to a dna fragment from the csf-1r promoter

PDB Compounds: (C:) runt-related transcription factor 1

SCOPe Domain Sequences for d1io4c_:

Sequence; same for both SEQRES and ATOM records:

>d1io4c_ b.2.5.6 (C:) Acute myeloid leukemia 1 protein (AML1), RUNT domain {Mouse (Mus musculus) [TaxId: 10090]}
gelvrtdspnflcsvlpthwrcnktlpiafkvvalgdvpdgtlvtvmagndenysaelrn
ataamknqvarfndlrfvgrsgrgksftltitvftnppqvatyhraikitvdgpreprrh

Timeline for d1io4c_:

• d1io4c_ first appeared in SCOP 1.57
  
• d1io4c_ appears in SCOPe 2.05
  
• d1io4c_ appears in SCOPe 2.07
  
• d1io4c_ appears in the current release, SCOPe 2.08