Lineage for d1in1a1 (1in1 A:837-922)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2113755Fold c.15: BRCT domain [52112] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 2113756Superfamily c.15.1: BRCT domain [52113] (6 families) (S)
    Pfam PF00533
  5. 2113769Family c.15.1.2: DNA ligase [52117] (3 proteins)
  6. 2113770Protein DNA ligase III alpha [63958] (1 species)
  7. 2113771Species Human (Homo sapiens) [TaxId:9606] [63959] (2 PDB entries)
  8. 2113773Domain d1in1a1: 1in1 A:837-922 [62594]
    Other proteins in same PDB: d1in1a2

Details for d1in1a1

PDB Entry: 1in1 (more details)

PDB Description: nmr structure of human dna ligase iiialpha brct domain
PDB Compounds: (A:) DNA ligase III

SCOPe Domain Sequences for d1in1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1in1a1 c.15.1.2 (A:837-922) DNA ligase III alpha {Human (Homo sapiens) [TaxId: 9606]}
adetlcqtkvlldiftgvrlylppstpdfsrlrryfvafdgdlvqefdmtsathvlgsrd
knpaaqqvspewiwacirkrrlvapc

SCOPe Domain Coordinates for d1in1a1:

Click to download the PDB-style file with coordinates for d1in1a1.
(The format of our PDB-style files is described here.)

Timeline for d1in1a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1in1a2