![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.15: BRCT domain [52112] (1 superfamily) 3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134 |
![]() | Superfamily c.15.1: BRCT domain [52113] (6 families) ![]() Pfam PF00533 |
![]() | Family c.15.1.2: DNA ligase [52117] (3 proteins) |
![]() | Protein DNA ligase III alpha [63958] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [63959] (2 PDB entries) |
![]() | Domain d1in1a1: 1in1 A:837-922 [62594] Other proteins in same PDB: d1in1a2 |
PDB Entry: 1in1 (more details)
SCOPe Domain Sequences for d1in1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1in1a1 c.15.1.2 (A:837-922) DNA ligase III alpha {Human (Homo sapiens) [TaxId: 9606]} adetlcqtkvlldiftgvrlylppstpdfsrlrryfvafdgdlvqefdmtsathvlgsrd knpaaqqvspewiwacirkrrlvapc
Timeline for d1in1a1: