SCOPe 2.04: Domain d1ijxe_: 1ijx E:

Lineage for d1ijxe_ (1ijx E:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.141: Frizzled cysteine-rich domain [63500] (1 superfamily)
   Core: 3 helices; irregular array; disulfide-rich

4. Superfamily a.141.1: Frizzled cysteine-rich domain [63501] (1 family)
   automatically mapped to Pfam PF01392

5. Family a.141.1.1: Frizzled cysteine-rich domain [63502] (2 proteins)

6. Protein Secreted Frizzled-related protein 3 (SFRP-3;fzb) [63503] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [63504] (1 PDB entry)

8. Domain d1ijxe_: 1ijx E: [62515]
   CASP4
   complexed with so4

Details for d1ijxe_

PDB Entry: 1ijx, 1.9 Å

PDB Description: crystal structure of the cysteine-rich domain of secreted frizzled- related protein 3 (sfrp-3;fzb)

PDB Compounds: (E:) secreted frizzled-related sequence protein 3

SCOPe Domain Sequences for d1ijxe_:

Sequence; same for both SEQRES and ATOM records:

>d1ijxe_ a.141.1.1 (E:) Secreted Frizzled-related protein 3 (SFRP-3;fzb) {Mouse (Mus musculus) [TaxId: 10090]}
acepvriplckslpwemtkmpnhlhhstqanailameqfegllgthcspdllfflcamya
pictidfqhepikpcksvcerarqgcepilikyrhswpeslacdelpvydrgvcispeai
vta

Timeline for d1ijxe_:

• d1ijxe_ first appeared in SCOP 1.57
  
• d1ijxe_ appears in SCOPe 2.03
  
• d1ijxe_ appears in SCOPe 2.05
  
• d1ijxe_ appears in the current release, SCOPe 2.08