Class a: All alpha proteins [46456] (284 folds) |
Fold a.141: Frizzled cysteine-rich domain [63500] (1 superfamily) Core: 3 helices; irregular array; disulfide-rich |
Superfamily a.141.1: Frizzled cysteine-rich domain [63501] (1 family) automatically mapped to Pfam PF01392 |
Family a.141.1.1: Frizzled cysteine-rich domain [63502] (2 proteins) |
Protein Secreted Frizzled-related protein 3 (SFRP-3;fzb) [63503] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [63504] (1 PDB entry) |
Domain d1ijxe_: 1ijx E: [62515] CASP4 complexed with so4 |
PDB Entry: 1ijx (more details), 1.9 Å
SCOPe Domain Sequences for d1ijxe_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ijxe_ a.141.1.1 (E:) Secreted Frizzled-related protein 3 (SFRP-3;fzb) {Mouse (Mus musculus) [TaxId: 10090]} acepvriplckslpwemtkmpnhlhhstqanailameqfegllgthcspdllfflcamya pictidfqhepikpcksvcerarqgcepilikyrhswpeslacdelpvydrgvcispeai vta
Timeline for d1ijxe_: