Lineage for d1ijxf_ (1ijx F:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1284090Fold a.141: Frizzled cysteine-rich domain [63500] (1 superfamily)
    Core: 3 helices; irregular array; disulfide-rich
  4. 1284091Superfamily a.141.1: Frizzled cysteine-rich domain [63501] (1 family) (S)
    automatically mapped to Pfam PF01392
  5. 1284092Family a.141.1.1: Frizzled cysteine-rich domain [63502] (2 proteins)
  6. 1284097Protein Secreted Frizzled-related protein 3 (SFRP-3;fzb) [63503] (1 species)
  7. 1284098Species Mouse (Mus musculus) [TaxId:10090] [63504] (1 PDB entry)
  8. 1284104Domain d1ijxf_: 1ijx F: [62516]
    CASP4
    complexed with so4

Details for d1ijxf_

PDB Entry: 1ijx (more details), 1.9 Å

PDB Description: crystal structure of the cysteine-rich domain of secreted frizzled- related protein 3 (sfrp-3;fzb)
PDB Compounds: (F:) secreted frizzled-related sequence protein 3

SCOPe Domain Sequences for d1ijxf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ijxf_ a.141.1.1 (F:) Secreted Frizzled-related protein 3 (SFRP-3;fzb) {Mouse (Mus musculus) [TaxId: 10090]}
aacepvriplckslpwemtkmpnhlhhstqanailameqfegllgthcspdllfflcamy
apictidfqhepikpcksvcerarqgcepilikyrhswpeslacdelpvydrgvcispea
ivtad

SCOPe Domain Coordinates for d1ijxf_:

Click to download the PDB-style file with coordinates for d1ijxf_.
(The format of our PDB-style files is described here.)

Timeline for d1ijxf_: