Class b: All beta proteins [48724] (119 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species) |
Species Fc (human) IgG1 class [49120] (14 PDB entries) |
Domain d1iixb2: 1iix B:342-443 [62465] Other proteins in same PDB: d1iixc1, d1iixc2 complexed with fuc, man, nag |
PDB Entry: 1iix (more details), 3.5 Å
SCOP Domain Sequences for d1iixb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iixb2 b.1.1.2 (B:342-443) Immunoglobulin (constant domains of L and H chains) {Fc (human) IgG1 class} qprepqvytlppsreemtknqvsltclvkgfypsdiavewesngqpennykttppvldsd gsfflyskltvdksrwqqgnvfscsvmhealhnhytqkslsl
Timeline for d1iixb2:
View in 3D Domains from other chains: (mouse over for more information) d1iixa1, d1iixa2, d1iixc1, d1iixc2 |