SCOP 1.63: Domain d1iilf2: 1iil F:251-361

Lineage for d1iilf2 (1iil F:251-361)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.4: I set domains [49159] (27 proteins)

6. Protein Fibroblast growth factor receptor, FGFR [49179] (3 species)

7. Species Human (Homo sapiens), FGFR2a [TaxId:9606] [49181] (5 PDB entries)

8. Domain d1iilf2: 1iil F:251-361 [62440]
   Other proteins in same PDB: d1iila_, d1iilb_, d1iilc_, d1iild_

Details for d1iilf2

PDB Entry: 1iil, 2.3 Å

PDB Description: crystal structure of pro253arg apert mutant fgf receptor 2 (fgfr2) in complex with fgf2

SCOP Domain Sequences for d1iilf2:

Sequence, based on SEQRES records:

>d1iilf2 b.1.1.4 (F:251-361) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a}
rsrhrpilqaglpanastvvggdvefvckvysdaqphiqwikhvekngskygpdglpylk
vlkaagvnttdkeievlyirnvtfedageytclagnsigisfhsawltvlp

Sequence, based on observed residues (ATOM records):

>d1iilf2 b.1.1.4 (F:251-361) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a}
rsrhrpilqaglpanastvvggdvefvckvysdaqphiqwikhvpylkvlkaagvnttdk
eievlyirnvtfedageytclagnsigisfhsawltvlp

Timeline for d1iilf2:

• d1iilf2 first appeared in SCOP 1.57
  
• d1iilf2 appears in SCOP 1.61
  
• d1iilf2 appears in SCOP 1.65
  
• d1iilf2 appears in the current release, SCOPe 2.08