SCOPe 2.08: Domain d1ihrb_: 1ihr B:

Lineage for d1ihrb_ (1ihr B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.212: TolA/TonB C-terminal domain [74652] (1 superfamily)
   beta(2)-alpha-beta; 2 layers, alpha/beta; left-handed beta-alpha-beta unit in non-swapped monomer

4. Superfamily d.212.1: TolA/TonB C-terminal domain [74653] (3 families)

5. Family d.212.1.2: TonB [64326] (1 protein)
   isolated domain can form different segment-swapped dimers depending on the fragment length
   automatically mapped to Pfam PF03544

6. Protein TonB [64327] (1 species)

7. Species Escherichia coli [TaxId:562] [64328] (6 PDB entries)
   Uniprot P02929 150-239

8. Domain d1ihrb_: 1ihr B: [62393]
   forms segment-swapped dimer with a single coiled antiparallel beta-sheet
   complexed with br

Details for d1ihrb_

PDB Entry: 1ihr, 1.55 Å

PDB Description: Crystal structure of the dimeric C-terminal domain of TonB

PDB Compounds: (B:) TonB protein

SCOPe Domain Sequences for d1ihrb_:

Sequence; same for both SEQRES and ATOM records:

>d1ihrb_ d.212.1.2 (B:) TonB {Escherichia coli [TaxId: 562]}
araqalriegqvkvkfdvtpdgrvdnvqilsakpanmferevknamrrwryepgkpgsgi
vvnilfkingttei

Timeline for d1ihrb_:

• d1ihrb_ first appeared in SCOP 1.57
  
• d1ihrb_ appears in SCOPe 2.07