PDB entry 1ihr

View 1ihr on RCSB PDB site
Description: Crystal structure of the dimeric C-terminal domain of TonB
Class: protein transport
Keywords: novel fold, intertwined dimer, PROTEIN TRANSPORT
Deposited on 2001-04-20, released 2001-08-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.166
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: TonB protein
    Species: Escherichia coli [TaxId:562]
    Gene: JM83
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ihra_
  • Chain 'B':
    Compound: TonB protein
    Species: Escherichia coli [TaxId:562]
    Gene: JM83
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ihrb_
  • Heterogens: BR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ihrA (A:)
    paraqalriegqvkvkfdvtpdgrvdnvqilsakpanmferevknamrrwryepgkpgsg
    ivvnilfkingtteiq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ihrA (A:)
    araqalriegqvkvkfdvtpdgrvdnvqilsakpanmferevknamrrwryepgkpgsgi
    vvnilfkingtte
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ihrB (B:)
    paraqalriegqvkvkfdvtpdgrvdnvqilsakpanmferevknamrrwryepgkpgsg
    ivvnilfkingtteiq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ihrB (B:)
    araqalriegqvkvkfdvtpdgrvdnvqilsakpanmferevknamrrwryepgkpgsgi
    vvnilfkingttei