Lineage for d1ihrb_ (1ihr B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2612652Fold d.212: TolA/TonB C-terminal domain [74652] (1 superfamily)
    beta(2)-alpha-beta; 2 layers, alpha/beta; left-handed beta-alpha-beta unit in non-swapped monomer
  4. 2612653Superfamily d.212.1: TolA/TonB C-terminal domain [74653] (3 families) (S)
  5. 2612668Family d.212.1.2: TonB [64326] (1 protein)
    isolated domain can form different segment-swapped dimers depending on the fragment length
    automatically mapped to Pfam PF03544
  6. 2612669Protein TonB [64327] (1 species)
  7. 2612670Species Escherichia coli [TaxId:562] [64328] (6 PDB entries)
    Uniprot P02929 150-239
  8. 2612674Domain d1ihrb_: 1ihr B: [62393]
    forms segment-swapped dimer with a single coiled antiparallel beta-sheet
    complexed with br

Details for d1ihrb_

PDB Entry: 1ihr (more details), 1.55 Å

PDB Description: Crystal structure of the dimeric C-terminal domain of TonB
PDB Compounds: (B:) TonB protein

SCOPe Domain Sequences for d1ihrb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ihrb_ d.212.1.2 (B:) TonB {Escherichia coli [TaxId: 562]}
araqalriegqvkvkfdvtpdgrvdnvqilsakpanmferevknamrrwryepgkpgsgi
vvnilfkingttei

SCOPe Domain Coordinates for d1ihrb_:

Click to download the PDB-style file with coordinates for d1ihrb_.
(The format of our PDB-style files is described here.)

Timeline for d1ihrb_: