SCOPe 2.06: Domain d1ig9a2: 1ig9 A:376-901

Lineage for d1ig9a2 (1ig9 A:376-901)

1. Root: SCOPe 2.06

2. Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)

3. Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
   divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members

4. Superfamily e.8.1: DNA/RNA polymerases [56672] (7 families)
   "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain

5. Family e.8.1.1: DNA polymerase I [56673] (5 proteins)

6. Protein Family B DNA polymerase [56680] (7 species)

7. Species Bacteriophage RB69 [TaxId:12353] [56681] (92 PDB entries)

8. Domain d1ig9a2: 1ig9 A:376-901 [62368]
   Other proteins in same PDB: d1ig9a1
   protein/DNA complex; complexed with ca, ttp

Details for d1ig9a2

PDB Entry: 1ig9, 2.6 Å

PDB Description: structure of the replicating complex of a pol alpha family dna polymerase

PDB Compounds: (A:) DNA polymerase

SCOPe Domain Sequences for d1ig9a2:

Sequence; same for both SEQRES and ATOM records:

>d1ig9a2 e.8.1.1 (A:376-901) Family B DNA polymerase {Bacteriophage RB69 [TaxId: 12353]}
qnkvipqgrshpvqpypgafvkepipnrykyvmsfdltslypsiirqvnispetiagtfk
vaplhdyinavaerpsdvyscspngmmyykdrdgvvpteitkvfnqrkehkgymlaaqrn
geiikealhnpnlsvdepldvdyrfdfsdeikekikklsakslnemlfraqrtevagmta
qinrkllinslygalgnvwfryydlrnataittfgqmalqwierkvneylnevcgtegea
fvlygdtdsiyvsadkiidkvgeskfrdtnhwvdfldkfarermepaidrgfremceymn
nkqhlmfmdreaiagpplgskgiggfwtgkkryalnvwdmegtryaepklkimgletqks
stpkavqkalkecirrmlqegeeslqeyfkefekefrqlnyisiasvssanniakydvgg
fpgpkcpfhirgiltynraikgnidapqvvegekvyvlplregnpfgdkciawpsgteit
dlikddvlhwmdytvllektfikplegftsaakldyekkaslfdmf

Timeline for d1ig9a2:

• d1ig9a2 first appeared in SCOP 1.57
  
• d1ig9a2 appears in SCOPe 2.05
  
• d1ig9a2 appears in SCOPe 2.07
  
• d1ig9a2 appears in the current release, SCOPe 2.08