Lineage for d1if2a_ (1if2 A:)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 235645Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 235646Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (1 family) (S)
  5. 235647Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (1 protein)
  6. 235648Protein Triosephosphate isomerase [51353] (15 species)
  7. 235709Species Leishmania mexicana [TaxId:5665] [51360] (4 PDB entries)
  8. 235712Domain d1if2a_: 1if2 A: [62342]
    complexed with 129; mutant

Details for d1if2a_

PDB Entry: 1if2 (more details), 2 Å

PDB Description: x-ray structure of leishmania mexicana triosephosphate isomerase complexed with ipp

SCOP Domain Sequences for d1if2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1if2a_ c.1.1.1 (A:) Triosephosphate isomerase {Leishmania mexicana}
akpqpiaaanwkcngttasieklvqvfnehtishdvqcvvaptfvhiplvqaklrnpkyv
isaqnaiaksgaftgevsmpilkdigvhwvilghserrtyygetdeivaqkvseackqgf
mviacigetlqqreanqtakvvlsqtsaiaakltkdawnqvvlayepvwaigtgkvatpe
qaqevhlllrkwvsenigtdvaaklrilyggsvnaanaatlyakpdingflvggaslkpe
frdiidatr

SCOP Domain Coordinates for d1if2a_:

Click to download the PDB-style file with coordinates for d1if2a_.
(The format of our PDB-style files is described here.)

Timeline for d1if2a_: