Lineage for d1ib1h_ (1ib1 H:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1214850Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 1214851Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 1214852Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)
  6. 1215154Protein Serotonin N-acetyltranferase [55746] (1 species)
  7. 1215155Species Sheep (Ovis aries) [TaxId:9940] [55747] (7 PDB entries)
  8. 1215166Domain d1ib1h_: 1ib1 H: [62140]
    Other proteins in same PDB: d1ib1a_, d1ib1b_, d1ib1c_, d1ib1d_
    complexed with cot

Details for d1ib1h_

PDB Entry: 1ib1 (more details), 2.7 Å

PDB Description: crystal structure of the 14-3-3 zeta:serotonin n-acetyltransferase complex
PDB Compounds: (H:) serotonin n-acetyltransferase

SCOPe Domain Sequences for d1ib1h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ib1h_ d.108.1.1 (H:) Serotonin N-acetyltranferase {Sheep (Ovis aries) [TaxId: 9940]}
sgipgspgrqrrhtlpanefrcltpedaagvfeiereafisvsgncplnldevqhfltlc
pelslgwfvegrlvafiigslwdeerltqeslalhrprghsahlhalavhrsfrqqgkgs
vllwrylhhvgaqpavrravlmcedalvpfyqrfgfhpagpcaivvgsltftemhcslr

SCOPe Domain Coordinates for d1ib1h_:

Click to download the PDB-style file with coordinates for d1ib1h_.
(The format of our PDB-style files is described here.)

Timeline for d1ib1h_: