![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
![]() | Superfamily a.118.7: 14-3-3 protein [48445] (1 family) ![]() |
![]() | Family a.118.7.1: 14-3-3 protein [48446] (5 proteins) |
![]() | Protein zeta isoform [48449] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [48451] (7 PDB entries) |
![]() | Domain d1ib1d_: 1ib1 D: [62136] Other proteins in same PDB: d1ib1e_, d1ib1f_, d1ib1g_, d1ib1h_ complexed to serotonin N-acetyltransferase complexed with cot |
PDB Entry: 1ib1 (more details), 2.7 Å
SCOPe Domain Sequences for d1ib1d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ib1d_ a.118.7.1 (D:) zeta isoform {Human (Homo sapiens) [TaxId: 9606]} dknelvqkaklaeqaeryddmaacmksvteqgaelsneernllsvayknvvgarrsswrv vssieqktegaekkqqmareyrekietelrdicndvlsllekflipnasqaeskvfylkm kgdyyrylaevaagddkkgivdqsqqayqeafeiskkemqpthpirlglalnfsvfyyei lnspekacslaktafdeaiaeldtlseesykdstlimqllrdnltlw
Timeline for d1ib1d_: