![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
![]() | Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) ![]() |
![]() | Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins) |
![]() | Protein Serotonin N-acetyltranferase [55746] (1 species) |
![]() | Species Sheep (Ovis aries) [TaxId:9940] [55747] (7 PDB entries) |
![]() | Domain d1ib1g_: 1ib1 G: [62139] Other proteins in same PDB: d1ib1a_, d1ib1b_, d1ib1c_, d1ib1d_ complexed with cot |
PDB Entry: 1ib1 (more details), 2.7 Å
SCOPe Domain Sequences for d1ib1g_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ib1g_ d.108.1.1 (G:) Serotonin N-acetyltranferase {Sheep (Ovis aries) [TaxId: 9940]} sgipgspgrqrrhtlpanefrcltpedaagvfeiereafisvsgncplnldevqhfltlc pelslgwfvegrlvafiigslwdeerltqeslalhrprghsahlhalavhrsfrqqgkgs vllwrylhhvgaqpavrravlmcedalvpfyqrfgfhpagpcaivvgsltftemhcslr
Timeline for d1ib1g_: