Lineage for d1ib1g_ (1ib1 G:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 83053Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
  4. 83054Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (2 families) (S)
  5. 83055Family d.108.1.1: N-acetyl transferase, NAT [55730] (9 proteins)
  6. 83108Protein Serotonin N-acetyltranferase [55746] (1 species)
  7. 83109Species Sheep (Ovis aries) [TaxId:9940] [55747] (3 PDB entries)
  8. 83115Domain d1ib1g_: 1ib1 G: [62139]
    Other proteins in same PDB: d1ib1a_, d1ib1b_, d1ib1c_, d1ib1d_

Details for d1ib1g_

PDB Entry: 1ib1 (more details), 2.7 Å

PDB Description: crystal structure of the 14-3-3 zeta:serotonin n-acetyltransferase complex

SCOP Domain Sequences for d1ib1g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ib1g_ d.108.1.1 (G:) Serotonin N-acetyltranferase {Sheep (Ovis aries)}
sgipgspgrqrrhtlpanefrcltpedaagvfeiereafisvsgncplnldevqhfltlc
pelslgwfvegrlvafiigslwdeerltqeslalhrprghsahlhalavhrsfrqqgkgs
vllwrylhhvgaqpavrravlmcedalvpfyqrfgfhpagpcaivvgsltftemhcslr

SCOP Domain Coordinates for d1ib1g_:

Click to download the PDB-style file with coordinates for d1ib1g_.
(The format of our PDB-style files is described here.)

Timeline for d1ib1g_: