Lineage for d1iava_ (1iav A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129453Fold c.41: Subtilisin-like [52742] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 7 strands, order 2314567; left-handed crossover connection between strands 2 & 3
  4. 2129454Superfamily c.41.1: Subtilisin-like [52743] (3 families) (S)
  5. 2129455Family c.41.1.1: Subtilases [52744] (14 proteins)
  6. 2129534Protein Serine protease PB92 (subtilisin PB92) [52756] (1 species)
  7. 2129535Species Bacillus alcalophilus [TaxId:1445] [52757] (3 PDB entries)
    identical sequence to Bacillus lentus, TaxId: 1467
  8. 2129537Domain d1iava_: 1iav A: [62125]
    complexed with ca, so4

Details for d1iava_

PDB Entry: 1iav (more details), 1.8 Å

PDB Description: structure on native (asn 87) subtilisin from bacillus lentus
PDB Compounds: (A:) Subtilisin Savinase

SCOPe Domain Sequences for d1iava_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iava_ c.41.1.1 (A:) Serine protease PB92 (subtilisin PB92) {Bacillus alcalophilus [TaxId: 1445]}
aqsvpwgisrvqapaahnrgltgsgvkvavldtgisthpdlnirggasfvpgepstqdgn
ghgthvagtiaalnnsigvlgvapnaelyavkvlgasgsgsvssiaqglewagnngmhva
nlslgspspsatleqavnsatsrgvlvvaasgnsgagsisyparyanamavgatdqnnnr
asfsqygagldivapgvnvqstypgstyaslngtsmatphvagaaalvkqknpswsnvqi
rnhlkntatslgstnlygsglvnaeaatr

SCOPe Domain Coordinates for d1iava_:

Click to download the PDB-style file with coordinates for d1iava_.
(The format of our PDB-style files is described here.)

Timeline for d1iava_: