Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.41: Subtilisin-like [52742] (1 superfamily) 3 layers: a/b/a, parallel beta-sheet of 7 strands, order 2314567; left-handed crossover connection between strands 2 & 3 |
Superfamily c.41.1: Subtilisin-like [52743] (3 families) |
Family c.41.1.1: Subtilases [52744] (15 proteins) |
Protein Serine protease PB92 (subtilisin PB92) [52756] (1 species) |
Species Bacillus alcalophilus [TaxId:1445] [52757] (3 PDB entries) identical sequence to Bacillus lentus, TaxId: 1467 |
Domain d1iava_: 1iav A: [62125] complexed with ca, so4 |
PDB Entry: 1iav (more details), 1.8 Å
SCOPe Domain Sequences for d1iava_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iava_ c.41.1.1 (A:) Serine protease PB92 (subtilisin PB92) {Bacillus alcalophilus [TaxId: 1445]} aqsvpwgisrvqapaahnrgltgsgvkvavldtgisthpdlnirggasfvpgepstqdgn ghgthvagtiaalnnsigvlgvapnaelyavkvlgasgsgsvssiaqglewagnngmhva nlslgspspsatleqavnsatsrgvlvvaasgnsgagsisyparyanamavgatdqnnnr asfsqygagldivapgvnvqstypgstyaslngtsmatphvagaaalvkqknpswsnvqi rnhlkntatslgstnlygsglvnaeaatr
Timeline for d1iava_: