Lineage for d1iapa_ (1iap A:)
- Root: SCOP 1.59
Class a: All alpha proteins [46456] (151 folds) 
Fold a.91: Regulator of G-protein signalling, RGS [48096] (1 superfamily) Superfamily a.91.1: Regulator of G-protein signalling, RGS [48097] (1 family) 
Family a.91.1.1: Regulator of G-protein signalling, RGS [48098] (6 proteins) 
Protein p115RhoGEF [63584] (1 species) Species Human (Homo sapiens) [TaxId:9606] [63585] (1 PDB entry) 
Domain d1iapa_: 1iap A: [62119]
Details for d1iapa_
PDB Entry: 1iap (more details), 1.9 Å
PDB Description: crystal structure of p115rhogef rgrgs domain
SCOP Domain Sequences for d1iapa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iapa_ a.91.1.1 (A:) p115RhoGEF {Human (Homo sapiens)}
sqfqsleqvkrrpahlmallqhvalqfepgpllcclhadmlgslgpkeakkafldfyhsf
lektavlrvpvppnvafeldrtradlisedvqrrfvqevvqsqqvavgrqledfrskrlm
gmtpweqelaqleawvgrdrasyearerhvaerllmhleemqhtistdeeksaavvnaig
lymrhlgvrt
SCOP Domain Coordinates for d1iapa_:
Click to download the PDB-style file with coordinates for d1iapa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1iapa_:
- d1iapa_ first appeared in SCOP 1.57
- d1iapa_ appears in SCOP 1.61
- d1iapa_ appears in the current release, SCOPe 2.08
View in 3D