Lineage for d1ia1b_ (1ia1 B:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1180768Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 1180769Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 1180770Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins)
  6. 1180914Protein Dihydrofolate reductases, eukaryotic type [53605] (6 species)
  7. 1181018Species Yeast (Candida albicans) [TaxId:5476] [53609] (14 PDB entries)
  8. 1181028Domain d1ia1b_: 1ia1 B: [62104]
    complexed with ndp, po4, tq3

Details for d1ia1b_

PDB Entry: 1ia1 (more details), 1.7 Å

PDB Description: candida albicans dihydrofolate reductase complexed with dihydro- nicotinamide-adenine-dinucleotide phosphate (nadph) and 5- (phenylsulfanyl)-2,4-quinazolinediamine (gw997)
PDB Compounds: (B:) dihydrofolate reductase

SCOPe Domain Sequences for d1ia1b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ia1b_ c.71.1.1 (B:) Dihydrofolate reductases, eukaryotic type {Yeast (Candida albicans) [TaxId: 5476]}
mlkpnvaiivaalkpalgigykgkmpwrlrkeiryfkdvttrttkpntrnavimgrktwe
sipqkfrplpdrlniilsrsyeneiiddniihassiesslnlvsdvervfiiggaeiyne
linnslvshlliteiehpspesiemdtflkfpleswtkqpkselqkfvgdtvleddikeg
dftynytlwtrk

SCOPe Domain Coordinates for d1ia1b_:

Click to download the PDB-style file with coordinates for d1ia1b_.
(The format of our PDB-style files is described here.)

Timeline for d1ia1b_: