SCOPe 2.02: Domain d1ia1a_: 1ia1 A:

Lineage for d1ia1a_ (1ia1 A:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families)

5. Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins)

6. Protein Dihydrofolate reductases, eukaryotic type [53605] (6 species)

7. Species Yeast (Candida albicans) [TaxId:5476] [53609] (14 PDB entries)

8. Domain d1ia1a_: 1ia1 A: [62103]
   complexed with ndp, po4, tq3

Details for d1ia1a_

PDB Entry: 1ia1, 1.7 Å

PDB Description: candida albicans dihydrofolate reductase complexed with dihydro- nicotinamide-adenine-dinucleotide phosphate (nadph) and 5- (phenylsulfanyl)-2,4-quinazolinediamine (gw997)

PDB Compounds: (A:) dihydrofolate reductase

SCOPe Domain Sequences for d1ia1a_:

Sequence; same for both SEQRES and ATOM records:

>d1ia1a_ c.71.1.1 (A:) Dihydrofolate reductases, eukaryotic type {Yeast (Candida albicans) [TaxId: 5476]}
mlkpnvaiivaalkpalgigykgkmpwrlrkeiryfkdvttrttkpntrnavimgrktwe
sipqkfrplpdrlniilsrsyeneiiddniihassiesslnlvsdvervfiiggaeiyne
linnslvshlliteiehpspesiemdtflkfpleswtkqpkselqkfvgdtvleddikeg
dftynytlwtrk

Timeline for d1ia1a_:

• d1ia1a_ first appeared in SCOP 1.57
  
• d1ia1a_ appears in SCOPe 2.01
  
• d1ia1a_ appears in SCOPe 2.03
  
• d1ia1a_ appears in the current release, SCOPe 2.08