Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) |
Family d.14.1.1: Translational machinery components [54212] (5 proteins) |
Protein Ribosomal protein S9 [54218] (2 species) |
Species Thermus thermophilus [TaxId:274] [54219] (39 PDB entries) Uniprot P80374 |
Domain d1i95i_: 1i95 I: [62022] Other proteins in same PDB: d1i95b_, d1i95c1, d1i95c2, d1i95d_, d1i95e1, d1i95e2, d1i95f_, d1i95g_, d1i95h_, d1i95j_, d1i95k_, d1i95l_, d1i95m_, d1i95n_, d1i95o_, d1i95p_, d1i95q_, d1i95r_, d1i95s_, d1i95t_, d1i95u_ complexed with ede, mg, wo2, zn |
PDB Entry: 1i95 (more details), 4.5 Å
SCOPe Domain Sequences for d1i95i_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i95i_ d.14.1.1 (I:) Ribosomal protein S9 {Thermus thermophilus [TaxId: 274]} eqyygtgrrkeavarvflrpgngkvtvngqdfneyfqglvravaaleplravdalgrfda yitvrgggksgqidaiklgiaralvqynpdyraklkplgfltrdarvverkkygkhkarr apqyskr
Timeline for d1i95i_: