SCOPe 2.08: Domain d1i95j_: 1i95 J:

Lineage for d1i95j_ (1i95 J:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.15: Ribosomal protein S10 [54999] (1 family)
   automatically mapped to Pfam PF00338

5. Family d.58.15.1: Ribosomal protein S10 [55000] (1 protein)

6. Protein Ribosomal protein S10 [55001] (2 species)

7. Species Thermus thermophilus [TaxId:274] [55002] (45 PDB entries)
   Uniprot P80375

8. Domain d1i95j_: 1i95 J: [62023]
   Other proteins in same PDB: d1i95b_, d1i95c1, d1i95c2, d1i95d_, d1i95e1, d1i95e2, d1i95f_, d1i95g_, d1i95h_, d1i95i_, d1i95k_, d1i95l_, d1i95m_, d1i95n_, d1i95o_, d1i95p_, d1i95q_, d1i95r_, d1i95s_, d1i95t_, d1i95u_
   complexed with ede, mg, wo2, zn

Details for d1i95j_

PDB Entry: 1i95, 4.5 Å

PDB Description: crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with edeine

PDB Compounds: (J:) 30S ribosomal protein S10

SCOPe Domain Sequences for d1i95j_:

Sequence; same for both SEQRES and ATOM records:

>d1i95j_ d.58.15.1 (J:) Ribosomal protein S10 {Thermus thermophilus [TaxId: 274]}
kiriklrgfdhktldasaqkiveaarrsgaqvsgpiplptrvrrftvirgpfkhkdsreh
felrthnrlvdiinpnrktieqlmtldlptgveieikt

Timeline for d1i95j_:

• d1i95j_ first appeared in SCOP 1.57
  
• d1i95j_ appears in SCOPe 2.07