SCOP 1.65: Domain d1i94c1: 1i94 C:2-106

Lineage for d1i94c1 (1i94 C:2-106)

1. Root: SCOP 1.65

2. Class d: Alpha and beta proteins (a+b) [53931] (234 folds)

3. Fold d.52: Alpha-lytic protease prodomain-like [54805] (7 superfamilies)
   core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta

4. Superfamily d.52.3: Prokaryotic type KH domain (KH-domain type II) [54814] (1 family)
   Prokaryotic and eukaryotic domains share a KH-motif but have different topologies

5. Family d.52.3.1: Prokaryotic type KH domain (KH-domain type II) [54815] (4 proteins)

6. Protein Ribosomal protein S3 N-terminal domain [54816] (1 species)

7. Species Thermus thermophilus [TaxId:274] [54817] (14 PDB entries)

8. Domain d1i94c1: 1i94 C:2-106 [61992]
   Other proteins in same PDB: d1i94b_, d1i94c2, d1i94d_, d1i94e1, d1i94e2, d1i94f_, d1i94g_, d1i94h_, d1i94i_, d1i94j_, d1i94k_, d1i94l_, d1i94m_, d1i94n_, d1i94o_, d1i94p_, d1i94q_, d1i94r_, d1i94s_, d1i94t_, d1i94u_
   complexed with mg, wo2, zn

Details for d1i94c1

PDB Entry: 1i94, 3.2 Å

PDB Description: crystal structures of the small ribosomal subunit with tetracycline, edeine and if3

SCOP Domain Sequences for d1i94c1:

Sequence; same for both SEQRES and ATOM records:

>d1i94c1 d.52.3.1 (C:2-106) Ribosomal protein S3 N-terminal domain {Thermus thermophilus}
gnkihpigfrlgitrdwesrwyagkkqyrhllledqrirgllekelysaglarvdieraa
dnvavtvhvakpgvvigrggerirvlreelakltgknvalnvqev

Timeline for d1i94c1:

• d1i94c1 first appeared in SCOP 1.57
  
• d1i94c1 appears in SCOP 1.63
  
• d1i94c1 appears in SCOP 1.67
  
• d1i94c1 appears in the current release, SCOPe 2.08