Lineage for d1i94m_ (1i94 M:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 286743Fold a.156: S13-like H2TH domain [81297] (1 superfamily)
    core: 3-4 helices
  4. 286744Superfamily a.156.1: S13-like H2TH domain [46946] (3 families) (S)
    contains a helix-two turns-helix (H2TH) motif
  5. 286745Family a.156.1.1: Ribosomal protein S13 [46947] (1 protein)
    contains 3 helices and a beta-hairpin in the core and a non-globular C-terminal extension
  6. 286746Protein Ribosomal protein S13 [46948] (1 species)
  7. 286747Species Thermus thermophilus [TaxId:274] [46949] (14 PDB entries)
  8. 286754Domain d1i94m_: 1i94 M: [62004]
    Other proteins in same PDB: d1i94b_, d1i94c1, d1i94c2, d1i94d_, d1i94e1, d1i94e2, d1i94f_, d1i94g_, d1i94h_, d1i94i_, d1i94j_, d1i94k_, d1i94l_, d1i94n_, d1i94o_, d1i94p_, d1i94q_, d1i94r_, d1i94s_, d1i94t_, d1i94u_
    complexed with mg, wo2, zn

Details for d1i94m_

PDB Entry: 1i94 (more details), 3.2 Å

PDB Description: crystal structures of the small ribosomal subunit with tetracycline, edeine and if3

SCOP Domain Sequences for d1i94m_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i94m_ a.156.1.1 (M:) Ribosomal protein S13 {Thermus thermophilus}
ariagveiprnkrvdvaltyiygigkarakealektginpatrvkdlteaevvrlreyve
ntwklegelraevaanikrlmdigcyrglrhrr

SCOP Domain Coordinates for d1i94m_:

Click to download the PDB-style file with coordinates for d1i94m_.
(The format of our PDB-style files is described here.)

Timeline for d1i94m_: