Lineage for d1i8oa_ (1i8o A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1476826Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 1476827Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 1476828Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)
  6. 1476839Protein Cytochrome c2 [46650] (8 species)
  7. 1476860Species Rhodopseudomonas palustris [TaxId:1076] [46655] (4 PDB entries)
  8. 1476861Domain d1i8oa_: 1i8o A: [61979]
    complexed with hec, nh3, so4

Details for d1i8oa_

PDB Entry: 1i8o (more details), 1.15 Å

PDB Description: rhodopseudomonas palustris cyt c2 ammonia complex at 1.15 angstrom resolution
PDB Compounds: (A:) cytochrome c2

SCOPe Domain Sequences for d1i8oa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i8oa_ a.3.1.1 (A:) Cytochrome c2 {Rhodopseudomonas palustris [TaxId: 1076]}
edakageavfkqcmtchradknmvgpalagvvgrkagtaagftysplnhnsgeaglvwta
dnivpyladpnaflkkfltekgkadqavgvtkmtfklaneqqrkdvvaylatlk

SCOPe Domain Coordinates for d1i8oa_:

Click to download the PDB-style file with coordinates for d1i8oa_.
(The format of our PDB-style files is described here.)

Timeline for d1i8oa_: