SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1i8oa_ (1i8o A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1980368Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 1980369Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 1980370Family a.3.1.1: monodomain cytochrome c [46627] (16 protein domains)
  6. 1980381Protein Cytochrome c2 [46650] (8 species)
  7. 1980402Species Rhodopseudomonas palustris [TaxId:1076] [46655] (4 PDB entries)
  8. 1980403Domain d1i8oa_: 1i8o A: [61979]
    complexed with hec, nh3, so4

Details for d1i8oa_

PDB Entry: 1i8o (more details), 1.15 Å

PDB Description: rhodopseudomonas palustris cyt c2 ammonia complex at 1.15 angstrom resolution
PDB Compounds: (A:) cytochrome c2

SCOPe Domain Sequences for d1i8oa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i8oa_ a.3.1.1 (A:) Cytochrome c2 {Rhodopseudomonas palustris [TaxId: 1076]}
edakageavfkqcmtchradknmvgpalagvvgrkagtaagftysplnhnsgeaglvwta
dnivpyladpnaflkkfltekgkadqavgvtkmtfklaneqqrkdvvaylatlk

SCOPe Domain Coordinates for d1i8oa_:

Click to download the PDB-style file with coordinates for d1i8oa_.
(The format of our PDB-style files is described here.)

Timeline for d1i8oa_: