Class b: All beta proteins [48724] (126 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.3: C2 set domains [49142] (7 proteins) |
Protein CD80, second domain [49157] (1 species) a soluble form of b7-1 |
Species Human (Homo sapiens) [TaxId:9606] [49158] (2 PDB entries) |
Domain d1i8lb2: 1i8l B:106-199 [61973] Other proteins in same PDB: d1i8la1, d1i8lb1, d1i8lc_, d1i8ld_ complexed to ctla-4 complexed with man, nag |
PDB Entry: 1i8l (more details), 3 Å
SCOP Domain Sequences for d1i8lb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i8lb2 b.1.1.3 (B:106-199) CD80, second domain {Human (Homo sapiens)} adfptpsisdfeiptsnirriicstsggfpephlswlengeelnainttvsqdpetelya vsskldfnmttnhsfmclikyghlrvnqtfnwnt
Timeline for d1i8lb2:
View in 3D Domains from other chains: (mouse over for more information) d1i8la1, d1i8la2, d1i8lc_, d1i8ld_ |