Lineage for d1i8la1 (1i8l A:1-105)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 287097Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)
  6. 287174Protein CD80, N-terminal domain [48745] (1 species)
    a soluble form of b7-1
  7. 287175Species Human (Homo sapiens) [TaxId:9606] [48746] (2 PDB entries)
  8. 287177Domain d1i8la1: 1i8l A:1-105 [61970]
    Other proteins in same PDB: d1i8la2, d1i8lb2, d1i8lc_, d1i8ld_

Details for d1i8la1

PDB Entry: 1i8l (more details), 3 Å

PDB Description: human b7-1/ctla-4 co-stimulatory complex

SCOP Domain Sequences for d1i8la1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i8la1 b.1.1.1 (A:1-105) CD80, N-terminal domain {Human (Homo sapiens)}
vihvtkevkevatlscghnvsveelaqtriywqkekkmvltmmsgdmniwpeyknrtifd
itnnlsivilalrpsdegtyecvvlkyekdafkrehlaevtlsvk

SCOP Domain Coordinates for d1i8la1:

Click to download the PDB-style file with coordinates for d1i8la1.
(The format of our PDB-style files is described here.)

Timeline for d1i8la1: