Lineage for d1i8lb2 (1i8l B:106-199)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 54224Family b.1.1.3: C2 set domains [49142] (7 proteins)
  6. 54260Protein CD80, second domain [49157] (1 species)
  7. 54261Species Human (Homo sapiens) [TaxId:9606] [49158] (2 PDB entries)
  8. 54264Domain d1i8lb2: 1i8l B:106-199 [61973]
    Other proteins in same PDB: d1i8la1, d1i8lb1, d1i8lc_, d1i8ld_

Details for d1i8lb2

PDB Entry: 1i8l (more details), 3 Å

PDB Description: human b7-1/ctla-4 co-stimulatory complex

SCOP Domain Sequences for d1i8lb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i8lb2 b.1.1.3 (B:106-199) CD80, second domain {Human (Homo sapiens)}
adfptpsisdfeiptsnirriicstsggfpephlswlengeelnainttvsqdpetelya
vsskldfnmttnhsfmclikyghlrvnqtfnwnt

SCOP Domain Coordinates for d1i8lb2:

Click to download the PDB-style file with coordinates for d1i8lb2.
(The format of our PDB-style files is described here.)

Timeline for d1i8lb2: