Class b: All beta proteins [48724] (119 folds) |
Fold b.38: Sm-like fold [50181] (2 superfamilies) core: barrel, open; n*=4, S*=8; meander; SH3-like topology |
Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (3 families) |
Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (6 proteins) forms homo and heteroheptameric ring structures |
Protein Archaeal homoheptameric Sm protein [63758] (5 species) |
Species Archaeon Pyrobaculum aerophilum [TaxId:13773] [63760] (1 PDB entry) |
Domain d1i8fg_: 1i8f G: [61965] structural genomics protein; complexed with gol |
PDB Entry: 1i8f (more details), 1.75 Å
SCOP Domain Sequences for d1i8fg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i8fg_ b.38.1.1 (G:) Archaeal homoheptameric Sm protein {Archaeon Pyrobaculum aerophilum} gatlqdsigkqvlvklrdsheirgilrsfdqhvnllledaeeiidgnvykrgtmvvrgen vlfispvp
Timeline for d1i8fg_: