![]() | Class b: All beta proteins [48724] (126 folds) |
![]() | Fold b.38: Sm-like fold [50181] (2 superfamilies) core: barrel, open; n*=4, S*=8; meander; SH3-like topology |
![]() | Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (3 families) ![]() |
![]() | Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (7 proteins) forms homo and heteroheptameric ring structures |
![]() | Protein Archaeal homoheptameric Sm protein [63758] (5 species) |
![]() | Species Archaeon Pyrobaculum aerophilum [TaxId:13773] [63760] (2 PDB entries) smap1 |
![]() | Domain d1i8ff_: 1i8f F: [61964] |
PDB Entry: 1i8f (more details), 1.75 Å
SCOP Domain Sequences for d1i8ff_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i8ff_ b.38.1.1 (F:) Archaeal homoheptameric Sm protein {Archaeon Pyrobaculum aerophilum} iskcfatlgatlqdsigkqvlvklrdsheirgilrsfdqhvnllledaeeiidgnvykrg tmvvrgenvlfispvpg
Timeline for d1i8ff_: